PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400012586
Common NameLOC102585599
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family BES1
Protein Properties Length: 316aa    MW: 33905.1 Da    PI: 9.0725
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400012586genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822206.48e-6421451150
                DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasas 89 
                           ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gny+lpk++DnneVlkALc+eAGw+ve DGttyrkg+kp e+ +  g s+s s
  PGSC0003DMP400012586   2 TSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYQLPKHCDNNEVLKALCNEAGWTVELDGTTYRKGCKPVERLDFLGGSTSLS 90 
                           5899************************************************************************************* PP

                DUF822  90 pesslqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsssl 150
                           p+ss+q        +sp +s ++sp+sssfpsp+s++ + + +   +sl+p+l++ls+ sss+
  PGSC0003DMP400012586  91 PCSSYQ--------PSPFTSNNPSPASSSFPSPASSSYAANLNMdgKSLIPWLKNLSSGSSSA 145
                           ******........9****************9988766554433459*********9966654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.1E-633139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MTSGTRMPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY QLPKHCDNNE VLKALCNEAG  60
WTVELDGTTY RKGCKPVERL DFLGGSTSLS PCSSYQPSPF TSNNPSPASS SFPSPASSSY  120
AANLNMDGKS LIPWLKNLSS GSSSASSSKL PNFHIHTGSI SAPVTPPFSS PTARTPRIKT  180
DAGWAGFRYP YLPSSTPASP GRQNFINAEC FAGISGPPSP TYSLVSPNPF GFKMDSLSRG  240
GSRMCTPGQS GTCSPAIAAG LDRNADVPMA EVMISDEFAF GSNIAGMVKP WEGERIHEDC  300
VPDDLELTLG SSKTR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006348323.10.0PREDICTED: BES1/BZR1 homolog protein 4
SwissprotQ9ZV881e-122BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLM1AAC80.0M1AAC8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000182820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19842464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-108BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]